missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Integrin beta 1/CD29 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-62660-25ul
This item is not returnable.
View return policy
Description
Integrin beta 1/CD29 Polyclonal antibody specifically detects Integrin beta 1/CD29 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)
Specifications
| Integrin beta 1/CD29 | |
| Polyclonal | |
| Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
| CD29, CD29 antigen, Fibronectin receptor subunit beta, FNRBVLAB, GPIIA, integrin beta-1, integrin VLA-4 beta subunit, integrin, beta 1 (fibronectin receptor, beta polypeptide, antigen CD29 includesMDF2, MSK12), MDF2, MSK12, very late activation protein, beta polypeptide, VLA-4 subunit beta, VLA-BETA | |
| This antibody was developed against a recombinant protein corresponding to amino acids: FQGQTCEMCQTCLGVCAEHKECVQCRAFNKGEKKDTCTQECSYFNITKVESRDKLPQPVQPDPVSHCKEKDVDDCWFYFTYSVNGNNE | |
| 25 μL | |
| Cancer, Cell Biology, Cellular Markers, Cytokine Research, Immunology, Mesenchymal Stem Cell Markers, Neuronal Cell Markers, Signal Transduction, Stem Cell Markers | |
| 3688 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol | |
| Rabbit | |
| Protein A purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction