missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
ING3 Polyclonal antibody specifically detects ING3 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)
Specifications
Specifications
| Antigen | ING3 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Immunohistochemistry 1:1000 - 1:2500, Immunohistochemistry-Paraffin 1:1000 - 1:2500 |
| Formulation | PBS, pH 7.2, containing 40% glycerol |
| Gene Alias | FLJ20089, ING2, inhibitor of growth family, member 3, inhibitor of growth protein 3, MEAF4, P47, p47ING3Eaf4 |
| Host Species | Rabbit |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: KLDQELAKFKMELEADNAGITEILERRSLELDTPSQPVNNHHAHSHTPVEKRKYNPTSHHTTTDHIPEKKFKSEALLSTLT |
| Purification Method | Affinity purified |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?