missing translation for 'onlineSavingsMsg'
Learn More
Learn More
IFIT5 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-58887
This item is not returnable.
View return policy
Description
IFIT5 Polyclonal specifically detects IFIT5 in Human samples. It is validated for Western Blot.
Specifications
| IFIT5 | |
| Polyclonal | |
| Unconjugated | |
| PBS, 2% Sucrose with 0.09% Sodium Azide | |
| FLJ53857, IFIT-5, interferon-induced protein with tetratricopeptide repeats 5, Retinoic acid- and interferon-inducible 58 kDa protein, retinoic acid- and interferon-inducible protein (58kD), RI58FLJ92678 | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| 24138 | |
| Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Western Blot | |
| 0.5 mg/ml | |
| Western Blot 1.0 ug/ml | |
| Q13325 | |
| IFIT5 | |
| Synthetic peptides corresponding to IFIT5(interferon-induced protein with tetratricopeptide repeats 5) The peptide sequence was selected from the middle region of IFIT5. Peptide sequence ITVYRLDDSDREGSVKSFSLGPLRKAVTLNPDNSYIKVFLALKLQDVHAE. | |
| 100 μL | |
| Primary | |
| Expected identity based on immunogen sequence: Human: 100%; Bovine: 92%; Canine: 92%; Pig: 92%; Equine: 78%. | |
| Human, Mouse, Rat, Pig, Bovine, Canine, Equine | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction