Learn More
Abnova™ ID1 Recombinant Protein
Human ID1 full-length ORF recombinant protein with GST-tag at N-terminal
Brand: Abnova™ H00003397-P01.25ug
Additional Details : Weight : 0.00010kg
Description
The protein encoded by this gene is a helix-loop-helix (HLH) protein that can form heterodimers with members of the basic HLH family of transcription factors. The encoded protein has no DNA binding activity and therefore can inhibit the DNA binding and transcriptional activation ability of basic HLH proteins with which it interacts. This protein may play a role in cell growth, senescence, and differentiation. Two transcript variants encoding different isoforms have been found for this gene.
- Theoretical MW (kDa): 42.79
- Preparation method: In vitro wheat germ expression system
- Purification: Glutathione Sepharose 4 fast flow
- Storage buffer: 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer
Sequence: MKVASGSTATAAAGPSCALKAGKTASGAGEVVRCLSEQSVAISRCAGGAGARLPALLDEQQVNVLLYDMNGCYSRLKELVPTLPQNRKVSKVEILQHVIDYIRDLQLELNSESEVGTPGGRGLPVRAPLSTLNGEISALTAEAACVPADDRILCR
Best use within three months from the date of receipt of this protein.
ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array
Specifications
Antibody Production, ELISA, Protein Array, Western Blotting (Recombinant Protein) | |
50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer | |
Human ID1 Full-length ORF Recombinant Protein with GST-tag at N-terminal | |
In vitro wheat germ expression system | |
12.5% SDS-PAGE stained with Coomassie Blue | |
Wheat Germ (in vitro) | |
Human |
Solution | |
43.2 | |
8 | |
Glutathione Sepharose 4 Fast Flow | |
25μg | |
-80°C | |
Yes |