missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ ID1 Recombinant Protein

Product Code. 16106541
Click to view available options
Quantity:
10 μg
25 μg
Unit Size:
10µg
25µg
This item is not returnable. View return policy

Product Code. 16106541

Brand: Abnova™ H00003397P01.25ug

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Human ID1 full-length ORF recombinant protein with GST-tag at N-terminal

The protein encoded by this gene is a helix-loop-helix (HLH) protein that can form heterodimers with members of the basic HLH family of transcription factors. The encoded protein has no DNA binding activity and therefore can inhibit the DNA binding and transcriptional activation ability of basic HLH proteins with which it interacts. This protein may play a role in cell growth, senescence, and differentiation. Two transcript variants encoding different isoforms have been found for this gene.

  • Theoretical MW (kDa): 42.79
  • Preparation method: In vitro wheat germ expression system
  • Purification: Glutathione Sepharose 4 fast flow
  • Storage buffer: 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer

Sequence: MKVASGSTATAAAGPSCALKAGKTASGAGEVVRCLSEQSVAISRCAGGAGARLPALLDEQQVNVLLYDMNGCYSRLKELVPTLPQNRKVSKVEILQHVIDYIRDLQLELNSESEVGTPGGRGLPVRAPLSTLNGEISALTAEAACVPADDRILCR

Best use within three months from the date of receipt of this protein.

ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array

Specifications

For Use With (Application) Antibody Production, ELISA, Protein Array, Western Blot
Formulation 50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer
Molecular Weight (g/mol) 43.2
Name Human ID1 Full-length ORF Recombinant Protein with GST-tag at N-terminal
pH Range 8
Preparation Method In vitro wheat germ expression system
Purification Method Glutathione Sepharose 4 Fast Flow
Quality Control Testing 12.5% SDS-PAGE stained with Coomassie Blue
Quantity 25 μg
Source Wheat Germ (in vitro)
Storage Requirements -80°C
Cross Reactivity Human
Recombinant Recombinant
Form Solution
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.