missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human TUBB4Q Full-length ORF (AAI46476.1, 1 a.a. - 434 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00056604-P01.10ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16102223

  • 335.00€ / 10µg
Estimated Shipment: 26-06-2024
to see stock.
Add to basket

Description

Description

Sequence: MRELVLTQTGQCGNQIGAKFWEVISDEHAIDSAGTYHGDSHLQLERINVHHHEASGGRYVSRAVLVDLEPGTMDSVRSGPFGQVFRPDNFISRQCGAGNNWAKGRYTEGAELTESVMDVVRKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIWEEYPDRIINTLSILLLPKVSDTVVEPYNATLSVHQLIENADETFCIDNEALYDICSRTLKLPTPTYGDLNHLVSATMSGVTTCLCFPDQLNADLRKLAMNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVAELTQQMFDAKNMMAARDPRHGRYLTAAAIFQGRMPMREVDEQMFNIQDKNSSYFADWFPNNVKTAVCDIPPWGLKMSVTFTGNNTAVQELKRVSEQFTATFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATAEGGGV
Specifications

Specifications

AAI46476.1
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
74.69kDa
Glutathione Sepharose 4 Fast Flow
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
TUBB4Q
Wheat Germ (in vitro)
GST
Liquid
Antibody Production, Protein Array, ELISA, Western Blot
56604
TUBB4Q (Human) Recombinant Protein (P01)
12.5% SDS-PAGE Stained with Coomassie Blue.
MRELVLTQTGQCGNQIGAKFWEVISDEHAIDSAGTYHGDSHLQLERINVHHHEASGGRYVSRAVLVDLEPGTMDSVRSGPFGQVFRPDNFISRQCGAGNNWAKGRYTEGAELTESVMDVVRKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIWEEYPDRIINTLSILLLPKVSDTVVEPYNATLSVHQLIENADETFCIDNEALYDICSRTLKLPTPTYGDLNHLVSATMSGVTTCLCFPDQLNADLRKLAMNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVAELTQQMFDAKNMMAARDPRHGRYLTAAAIFQGRMPMREVDEQMFNIQDKNSSYFADWFPNNVKTAVCDIPPWGLKMSVTFTGNNTAVQELKRVSEQFTATFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATAEGGGV
RUO
TUBB4Q
Recombinant
wheat germ expression system
Product Suggestions

Product Suggestions

Videos
SDS
Documents

Documents

Certificates
Special Offers

Special Offers