Learn More
Abnova™ Human TSPAN9 Full-length ORF (AAH34280.1, 1 a.a. - 157 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Brand: Abnova™ H00010867-P01.10ug
Additional Details : Weight : 0.00010kg
Descrizione
The protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. [provided by RefSeq]
Sequence: MWGRPTFEQSCPALVPWPGFLVRSFSRLRRNPQSADSGADTSGRRDSADKCCSCTVGPGASCVFCCGWGGWVGLCLSMQFLIFVNINSKSLVHWEMCNLPENLFCFWSTSGVASGPRAFATVLPPAPTSSVCLQSLIYRSPRCLLYSLCAWPFCYLASpecifica
AAH34280.1 | |
Liquid | |
10867 | |
TSPAN9 (Human) Recombinant Protein (P01) | |
12.5% SDS-PAGE Stained with Coomassie Blue. | |
MWGRPTFEQSCPALVPWPGFLVRSFSRLRRNPQSADSGADTSGRRDSADKCCSCTVGPGASCVFCCGWGGWVGLCLSMQFLIFVNINSKSLVHWEMCNLPENLFCFWSTSGVASGPRAFATVLPPAPTSSVCLQSLIYRSPRCLLYSLCAWPFCYLA | |
RUO | |
TSPAN9 | |
Wheat Germ (in vitro) | |
GST |
Antibody Production, Array, Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein) | |
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
43.6kDa | |
Glutathione Sepharose 4 Fast Flow | |
10 ug | |
Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
NET-5/PP1057 | |
TSPAN9 | |
Yes | |
wheat germ expression system |