missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human TRIM38 Partial ORF (NP_006346, 367 a.a. - 464 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00010475-Q01.25ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16105172

  • 508.00€ / 25µg
Estimated Shipment: 18-07-2024
to see stock.
Add to basket

Description

Description

The protein encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The function of this protein has not been identified. [provided by RefSeq]

Sequence: NVQRGTGMKQEPQSGFWTLRLCKKKGYVALTSPPTSLHLHEQPLLVGIFLDYEAGVVSFYNGNTGCHIFTFPKASFSDTLRPYFQVYQYSPLFLPPPG
Specifications

Specifications

NP_006346
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
36.52kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
NVQRGTGMKQEPQSGFWTLRLCKKKGYVALTSPPTSLHLHEQPLLVGIFLDYEAGVVSFYNGNTGCHIFTFPKASFSDTLRPYFQVYQYSPLFLPPPG
RUO
TRIM38
Wheat Germ (in vitro)
GST
Liquid
Antibody Production, ELISA, Protein Array, Western Blot
10475
TRIM38 (Human) Recombinant Protein (Q01)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
MGC8946/RNF15/RORET
TRIM38
Recombinant
wheat germ expression system
Product Suggestions

Product Suggestions

Videos
SDS
Documents

Documents

Certificates
Special Offers

Special Offers