missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human TRIM11 Partial ORF (NP_660215.1, 132 a.a. - 230 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00081559-Q01.10ug

Additional Details : Weight : 0.02000kg

 View more versions of this product

Product Code. 16025695

  • 341.70€ / 10µg

Estimated Shipment: 24-01-2022
Add to basket

Description

Description

The protein encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. This protein localizes to the nucleus and the cytoplasm. Its function has not been identified. [provided by RefSeq]

Sequence: AEDLKAKLEKSLEHLRKQMQDALLFQAQADETCVLWQKMVESQRQNVLGEFERLRRLLAEEEQQLLQRLEEEELEVLPRLREGAAHLGQQSAHLAELIA
Specifications

Specifications

NP_660215.1
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
36.63kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
AEDLKAKLEKSLEHLRKQMQDALLFQAQADETCVLWQKMVESQRQNVLGEFERLRRLLAEEEQQLLQRLEEEELEVLPRLREGAAHLGQQSAHLAELIA
RUO
TRIM11
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
81559
TRIM11 (Human) Recombinant Protein (Q01)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
BIA1/RNF92
TRIM11
Yes
Videos
SDS
Documents
Certificates
Special Offers

Special Offers