Learn More
Abnova™ Human TNK1 Partial ORF (NP_003976, 559 a.a. - 666 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Brand: Abnova™ H00008711-Q01.10ug
Additional Details : Weight : 0.00010kg
Description
TNK1 is a nonreceptor tyrosine kinase. These kinases, like members of the SRC (MIM 190090) and JAK (see MIM 147795) families, mediate intracellular signaling downstream of receptor activation.[supplied by OMIM]
Sequence: WPERKPPHNHPMGMPGARKAAALSGGLLSDPELQRKIMEMELSVHWVTHQECQTALGATGGDVASAIRNLKVDQLFLLSSRSRADCWRILEHYQWDLSAASRYVLARPSpecifications
NP_003976 | |
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
37.62kDa | |
12.5% SDS-PAGE Stained with Coomassie Blue. | |
WPERKPPHNHPMGMPGARKAAALSGGLLSDPELQRKIMEMELSVHWVTHQECQTALGATGGDVASAIRNLKVDQLFLLSSRSRADCWRILEHYQWDLSAASRYVLARP | |
RUO | |
TNK1 | |
Wheat Germ (in vitro) | |
GST | |
Liquid |
Antibody Production, ELISA, Protein Array, Western Blot | |
8711 | |
TNK1 (Human) Recombinant Protein (Q01) | |
10 ug | |
Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
MGC46193 | |
TNK1 | |
Recombinant | |
wheat germ expression system |