missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human TMSB4Y Full-length ORF (NP_004193.1, 1 a.a. - 44 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Brand: Abnova™ H00009087-P01.10ug
Additional Details : Weight : 0.00010kg
Description
This gene lies within the male specific region of chromosome Y. Its homolog on chromosome X escapes X inactivation and encodes an actin sequestering protein. [provided by RefSeq]
Sequence: MSDKPGMAEIEKFDKSKLKKTETQEKNPLSSKETIEQERQAGESSpecifications
| NP_004193.1 | |
| Liquid | |
| 9087 | |
| TMSB4Y (Human) Recombinant Protein (P01) | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| MSDKPGMAEIEKFDKSKLKKTETQEKNPLSSKETIEQERQAGES | |
| RUO | |
| TMSB4Y | |
| Wheat Germ (in vitro) | |
| GST |
| Antibody Production, Array, Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein) | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 31.4kDa | |
| Glutathione Sepharose 4 Fast Flow | |
| 10 ug | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| MGC26307/TB4Y | |
| TMSB4Y | |
| Yes | |
| wheat germ expression system |