missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human TMSB4Y Full-length ORF (NP_004193.1, 1 a.a. - 44 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00009087-P01.10ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16103272

  • 335.00€ / 10µg
Estimated Shipment: 26-06-2024
to see stock.
Add to basket

Description

Description

This gene lies within the male specific region of chromosome Y. Its homolog on chromosome X escapes X inactivation and encodes an actin sequestering protein. [provided by RefSeq]

Sequence: MSDKPGMAEIEKFDKSKLKKTETQEKNPLSSKETIEQERQAGES
Specifications

Specifications

NP_004193.1
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
31.4kDa
Glutathione Sepharose 4 Fast Flow
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
MGC26307/TB4Y
TMSB4Y
Recombinant
wheat germ expression system
Antibody Production, Protein Array, ELISA, Western Blot
9087
TMSB4Y (Human) Recombinant Protein (P01)
12.5% SDS-PAGE Stained with Coomassie Blue.
MSDKPGMAEIEKFDKSKLKKTETQEKNPLSSKETIEQERQAGES
RUO
TMSB4Y
Wheat Germ (in vitro)
GST
Liquid
Product Suggestions

Product Suggestions

Videos
SDS
Documents

Documents

Certificates
Promotions

Promotions