missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human TIMP4 Full-length ORF (AAH10553.1, 1 a.a. - 224 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Brand: Abnova™ H00007079-P01.10ug
Additional Details : Weight : 0.00010kg
Description
This gene belongs to the TIMP gene family. The proteins encoded by this gene family are inhibitors of the matrix metalloproteinases, a group of peptidases involved in degradation of the extracellular matrix. The secreted, netrin domain-containing protein encoded by this gene is involved in regulation of platelet aggregation and recruitment and may play role in hormonal regulation and endometrial tissue remodeling. [provided by RefSeq]
Sequence: MPGSPRPAPSWVLLLRLLALLRPPGLGEACSCAPAHPQQHICHSALVIRAKISSEKVVPASADPADTEKMLRYEIKQIKMFKGFEKVKDVQYIYTPFDSSLCGVKLEANSQKQYLLTGQVLSDGKVFIHLCNYIEPWEGLSLVQRESLNHHYHLNCGCQITTCYTVPCTISAPNECLWTDWLLGRKLYGYQAQHYVCMKHVDGTCSWYRGHLPLRKEFVDIVQPSpecifications
| AAH10553.1 | |
| Liquid | |
| 7079 | |
| TIMP4 (Human) Recombinant Protein (P01) | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| MPGSPRPAPSWVLLLRLLALLRPPGLGEACSCAPAHPQQHICHSALVIRAKISSEKVVPASADPADTEKMLRYEIKQIKMFKGFEKVKDVQYIYTPFDSSLCGVKLEANSQKQYLLTGQVLSDGKVFIHLCNYIEPWEGLSLVQRESLNHHYHLNCGCQITTCYTVPCTISAPNECLWTDWLLGRKLYGYQAQHYVCMKHVDGTCSWYRGHLPLRKEFVDIVQP | |
| RUO | |
| TIMP4 | |
| Yes | |
| wheat germ expression system |
| Antibody Production, Array, Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein) | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 50.38kDa | |
| Glutathione Sepharose 4 Fast Flow | |
| 10 ug | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| TIMP4 | |
| Wheat Germ (in vitro) | |
| GST |