missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human TBX18 Partial ORF (XP_496819.1, 454 a.a. - 560 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Brand: Abnova™ H00009096-Q01.10ug
Additional Details : Weight : 0.02000kg
Description
Sequence: STLLQGTGNGVPATHPHLLSGSSCSSPAFHLGPNTSQLCSLAPADYSACARSGLTLNRYSTSLAETYNRLTNQAGETFAPPRTPSYVGVSSSTSVNMSMGGTDGDTFSpecifications
| XP_496819.1 | |
| Liquid | |
| 9096 | |
| TBX18 (Human) Recombinant Protein (Q01) | |
| 10 ug | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| TBX18 | |
| Wheat Germ (in vitro) | |
| GST |
| Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein) | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 37.4kDa | |
| 12.5% SDS-PAGE Stained with Coomassie Blue | |
| STLLQGTGNGVPATHPHLLSGSSCSSPAFHLGPNTSQLCSLAPADYSACARSGLTLNRYSTSLAETYNRLTNQAGETFAPPRTPSYVGVSSSTSVNMSMGGTDGDTF | |
| RUO | |
| TBX18 | |
| Yes | |
| wheat germ expression system |