missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human TBX18 Partial ORF (XP_496819.1, 454 a.a. - 560 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00009096-Q01.10ug

Additional Details : Weight : 0.02000kg

 View more versions of this product

Product Code. 16095125

  • 335.00€ / 10µg
Estimated Shipment: 30-07-2024
to see stock.
Add to basket

Description

Description

Sequence: STLLQGTGNGVPATHPHLLSGSSCSSPAFHLGPNTSQLCSLAPADYSACARSGLTLNRYSTSLAETYNRLTNQAGETFAPPRTPSYVGVSSSTSVNMSMGGTDGDTF
Specifications

Specifications

XP_496819.1
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
37.4kDa
12.5% SDS-PAGE Stained with Coomassie Blue
STLLQGTGNGVPATHPHLLSGSSCSSPAFHLGPNTSQLCSLAPADYSACARSGLTLNRYSTSLAETYNRLTNQAGETFAPPRTPSYVGVSSSTSVNMSMGGTDGDTF
RUO
TBX18
Recombinant
wheat germ expression system
Antibody Production, ELISA, Protein Array, Western Blot
9096
TBX18 (Human) Recombinant Protein (Q01)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
TBX18
Wheat Germ (in vitro)
GST
Liquid
Product Suggestions

Product Suggestions

Videos
SDS
Documents

Documents

Certificates
Special Offers

Special Offers