missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human SPINK1 Partial ORF (AAH25790, 24 a.a. - 79 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00006690-Q01.25ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16105785

  • 508.00€ / 25µg
Estimated Shipment: 31-05-2024
to see stock.
Add to basket

Description

Description

The protein encoded by this gene is a trypsin inhibitor, which is secreted from pancreatic acinar cells into pancreatic juice. It is thought to function in the prevention of trypsin-catalyzed premature activation of zymogens within the pancreas and the pancreatic duct. Mutations in this gene are associated with hereditary pancreatitis and tropical calcific pancreatitis. [provided by RefSeq]

Sequence: DSLGREAKCYNELNGCTKIYDPVCGTDGNTYPNECVLCFENRKRQTSILIQKSGPC
Specifications

Specifications

AAH25790
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
31.9kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
DSLGREAKCYNELNGCTKIYDPVCGTDGNTYPNECVLCFENRKRQTSILIQKSGPC
RUO
SPINK1
Wheat Germ (in vitro)
GST
Liquid
Antibody Production, ELISA, Protein Array, Western Blot
6690
SPINK1 (Human) Recombinant Protein (Q01)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
PCTT/PSTI/Spink3/TATI
SPINK1
Recombinant
wheat germ expression system
Product Suggestions

Product Suggestions

Videos
SDS
Documents

Documents

Certificates
Special Offers

Special Offers