Learn More
Abnova™ Human SLC2A4 Partial ORF (NP_001033, 467 a.a. - 509 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Brand: Abnova™ H00006517-Q01.25ug
Additional Details : Weight : 0.00010kg
Description
This gene is a member of the solute carrier family 2 (facilitated glucose transporter) family and encodes a protein that functions as an insulin-regulated facilitative glucose transporter. In the absence of insulin, this integral membrane protein is sequestered within the cells of muscle and adipose tissue. Within minutes of insulin stimulation, the protein moves to the cell surface and begins to transport glucose across the cell membrane. Mutations in this gene have been associated with noninsulin-dependent diabetes mellitus (NIDDM). [provided by RefSeq]
Sequence: RVPETRGRTFDQISAAFHRTPSLLEQEVKPSTELEYLGPDENDSpecifications
NP_001033 | |
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
30.47kDa | |
12.5% SDS-PAGE Stained with Coomassie Blue. | |
RVPETRGRTFDQISAAFHRTPSLLEQEVKPSTELEYLGPDEND | |
RUO | |
SLC2A4 | |
Wheat Germ (in vitro) | |
GST | |
Liquid |
Antibody Production, ELISA, Protein Array, Western Blot | |
6517 | |
SLC2A4 (Human) Recombinant Protein (Q01) | |
25 ug | |
Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
GLUT4 | |
SLC2A4 | |
Recombinant | |
wheat germ expression system |