missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human RNF167 Partial ORF (NP_056343, 78 a.a. - 172 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00026001-Q01.10ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16157992

  • 359.00€ / 10µg

Estimated Shipment: 24-08-2022
to see stock.
Add to basket

Description

Description

RNF167 is an E3 ubiquitin ligase that interacts with TSSC5 (SLC22A18; MIM 602631) and, together with UBCH6 (UBE2E1; MIM 602916), facilitates TSSC5 polyubiquitylation (Yamada and Gorbsky, 2006 [PubMed 16314844]).[supplied by OMIM]

Sequence: VNGSVFIALLRRFDCNFDLKVLNAQKAGYGAAVVHNVNSNELLNMVWNSEEIQQQIWIPSVFIGERSSEYLRALFVYEKGARVLLVPDNTFPLGY
Specifications

Specifications

NP_056343
Liquid
26001
RNF167 (Human) Recombinant Protein (Q01)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
5730408C10Rik/DKFZp566H073/LP2254/RING105
RNF167
Yes
wheat germ expression system
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
35.97kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
VNGSVFIALLRRFDCNFDLKVLNAQKAGYGAAVVHNVNSNELLNMVWNSEEIQQQIWIPSVFIGERSSEYLRALFVYEKGARVLLVPDNTFPLGY
RUO
RNF167
Wheat Germ (in vitro)
GST
Videos
SDS
Documents
Certificates
Special Offers

Special Offers