missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human PRPS2 Partial ORF (NP_002756, 160 a.a. - 269 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00005634-Q01.25ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16103515

  • 508.00€ / 25µg
Estimated Shipment: 26-06-2024
to see stock.
Add to basket

Description

Description

Sequence: AEWKNCIIVSPDAGGAKRVTSIADRLNVEFALIHKERKKANEVDRMVLVGDVKDRVAILVDDMADTCGTICHAADKLLSAGATKVYAILTHGIFSGPAISRINNAAFEAV
Spécification

Spécification

NP_002756
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
37.84kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
AEWKNCIIVSPDAGGAKRVTSIADRLNVEFALIHKERKKANEVDRMVLVGDVKDRVAILVDDMADTCGTICHAADKLLSAGATKVYAILTHGIFSGPAISRINNAAFEAV
RUO
PRPS2
Wheat Germ (in vitro)
GST
Liquid
Antibody Production, ELISA, Protein Array, Western Blot
5634
PRPS2 (Human) Recombinant Protein (Q01)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
PRSII
PRPS2
Recombinant
wheat germ expression system
Suggestions de produits

Suggestions de produits

Vidéos
FDS
Documents

Documents

Certificats
Promotions

Promotions