missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human PDE8A Partial ORF (NP_002596.1, 32 a.a. - 121 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00005151-Q01.10ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16102535

  • 335.00€ / 10µg
Estimated Shipment: 26-06-2024
to see stock.
Add to basket

Description

Description

Phosphodiesterases (PDEs) regulate the intracellular levels of cAMP and cGMP. These cyclic nucleotides play an important role as second messengers in multiple physiologic processes, including regulation of vascular resistance, cardiac output, visceral motility, immune response, inflammation, neuroplasticity, vision, and reproduction. PDEs comprise a large superfamily of enzymes divided into 10 families. Different PDEs can be distinguished by their structure, tissue expression, localization, substrate specificity, regulation, and sensitivity to PDE inhibitors. Diversity in structure and specificity of function make PDEs promising targets for the pharmacotherapy of diseases modulated by cyclic nucleotide signaling (Hetman et al., MIM 2000). See MIM 171885.[supplied by OMIM]

Sequence: RLPQGQKTAALPRTRGAGLLESELRDGSGKKVAVADVQFGPMRFHQDQLQVLLVFTKEDNQCNGFCRACEKAGFKCTVTKEAQAVLACFL
Specifications

Specifications

NP_002596.1
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
35.64kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
RLPQGQKTAALPRTRGAGLLESELRDGSGKKVAVADVQFGPMRFHQDQLQVLLVFTKEDNQCNGFCRACEKAGFKCTVTKEAQAVLACFL
RUO
PDE8A
Wheat Germ (in vitro)
GST
Liquid
Antibody Production, ELISA, Protein Array, Western Blot
5151
PDE8A (Human) Recombinant Protein (Q01)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
FLJ16150/HsT19550
PDE8A
Recombinant
wheat germ expression system
Suggestions de produits

Suggestions de produits

Vidéos
FDS
Documents

Documents

Certificats
Promotions

Promotions