missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human OSBPL8 Partial ORF (NP_065892.1, 244 a.a. - 346 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Brand: Abnova™ H00114882-Q01.25ug
Additional Details : Weight : 0.00010kg
Description
This gene encodes a member of the oxysterol-binding protein (OSBP) family, a group of intracellular lipid receptors. Like most members, the encoded protein contains an N-terminal pleckstrin homology domain and a highly conserved C-terminal OSBP-like sterol-binding domain. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]
Sequence: IIRATSESDGRCWMDALELALKCSSLLKRTMIREGKEHDLSVSSDSTHVTFYGLLRANNLHSGDNFQLNDSEIERQHFKDQDMYSDKSDKENDQEHDESDNEVSpecifications
| NP_065892.1 | |
| Liquid | |
| 114882 | |
| OSBPL8 (Human) Recombinant Protein (Q01) | |
| 25 ug | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| DKFZp686A11164/MGC126578/MGC133203/MST120/MSTP120/ORP8/OSBP10 | |
| OSBPL8 | |
| Yes | |
| wheat germ expression system |
| Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein) | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 37.07kDa | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| IIRATSESDGRCWMDALELALKCSSLLKRTMIREGKEHDLSVSSDSTHVTFYGLLRANNLHSGDNFQLNDSEIERQHFKDQDMYSDKSDKENDQEHDESDNEV | |
| RUO | |
| OSBPL8 | |
| Wheat Germ (in vitro) | |
| GST |