missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human NDUFA2 Full-length ORF (NP_002479.1, 1 a.a. - 99 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00004695-P01.10ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16158191

  • 359.00€ / 10µg

Estimated Shipment: 19-08-2022
to see stock.
Add to basket

Description

Description

The NDUFA2 gene encodes one of the accessory subunits of complex I, the first and largest complex of the mitochondrial respiratory chain (Hoefs et al., 2008 [PubMed 18513682]). For a discussion of complex I, see MIM 516000.[supplied by OMIM]

Sequence: MAAAAASRGVGAKLGLREIRIHLCQRSPGSQGVRDFIEKRYVELKKANPDLPILIRECSDVQPKLWARYAFGQETNVPLNNFSADQVTRALENVLSGKA
Specifications

Specifications

NP_002479.1
Liquid
4695
NDUFA2 (Human) Recombinant Protein (P01)
12.5% SDS-PAGE Stained with Coomassie Blue.
MAAAAASRGVGAKLGLREIRIHLCQRSPGSQGVRDFIEKRYVELKKANPDLPILIRECSDVQPKLWARYAFGQETNVPLNNFSADQVTRALENVLSGKA
RUO
NDUFA2
Wheat Germ (in vitro)
GST
Antibody Production, Array, Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
37.3kDa
Glutathione Sepharose 4 Fast Flow
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
B8/CD14
NDUFA2
Yes
wheat germ expression system
Videos
SDS
Documents
Certificates
Special Offers

Special Offers