Learn More
Abnova™ Human NDUFA2 Full-length ORF (NP_002479.1, 1 a.a. - 99 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Brand: Abnova™ H00004695-P01.25ug
Additional Details : Weight : 0.00010kg
Description
The NDUFA2 gene encodes one of the accessory subunits of complex I, the first and largest complex of the mitochondrial respiratory chain (Hoefs et al., 2008 [PubMed 18513682]). For a discussion of complex I, see MIM 516000.[supplied by OMIM]
Sequence: MAAAAASRGVGAKLGLREIRIHLCQRSPGSQGVRDFIEKRYVELKKANPDLPILIRECSDVQPKLWARYAFGQETNVPLNNFSADQVTRALENVLSGKASpécification
NP_002479.1 | |
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
37.3kDa | |
Glutathione Sepharose 4 Fast Flow | |
25 ug | |
Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
B8/CD14 | |
NDUFA2 | |
Recombinant | |
wheat germ expression system |
Antibody Production, Protein Array, ELISA, Western Blot | |
4695 | |
NDUFA2 (Human) Recombinant Protein (P01) | |
12.5% SDS-PAGE Stained with Coomassie Blue. | |
MAAAAASRGVGAKLGLREIRIHLCQRSPGSQGVRDFIEKRYVELKKANPDLPILIRECSDVQPKLWARYAFGQETNVPLNNFSADQVTRALENVLSGKA | |
RUO | |
NDUFA2 | |
Wheat Germ (in vitro) | |
GST | |
Liquid |