Learn More
Abnova™ Human MAGEC2 Partial ORF (NP_057333.1, 146 a.a. - 222 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Brand: Abnova™ H00051438-Q01.25ug
Additional Details : Weight : 0.00010kg
Description
This gene is related to members of the MAGEC gene family. It is not expressed in normal tissues, except for testis, and is expressed in tumors of various histological types. This gene and the MAGEC genes are clustered on chromosome Xq26-q27. [provided by RefSeq]
Sequence: AELVEFLLLKYEAEEPVTEAEMLMIVIKYKDYFPVILKRAREFMELLFGLALIEVGPDHFCVFANTVGLTDEGSDDESpecifications
NP_057333.1 | |
Liquid | |
51438 | |
MAGEC2 (Human) Recombinant Protein (Q01) | |
25 ug | |
Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
CT10/HCA587/MAGEE1/MGC13377 | |
MAGEC2 | |
Yes | |
wheat germ expression system |
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein) | |
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
34.21kDa | |
12.5% SDS-PAGE Stained with Coomassie Blue. | |
AELVEFLLLKYEAEEPVTEAEMLMIVIKYKDYFPVILKRAREFMELLFGLALIEVGPDHFCVFANTVGLTDEGSDDE | |
RUO | |
MAGEC2 | |
Wheat Germ (in vitro) | |
GST |