missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human LZTFL1 Partial ORF (NP_065080, 200 a.a. - 299 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00054585-Q01.10ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16107646

  • 335.00€ / 10µg
Estimated Shipment: 24-05-2024
to see stock.
Aggiungi al carrello

Descrizione

Descrizione

Sequence: KDFIKAQDLSNLENTVAALKSEFQKTLNDKTENQKSLEENLATAKHDLLRVQEQLHMAEKELEKKFQQTAAYRNMKEILTKKNDQIKDLRKRLAQYEPED
Specifica

Specifica

NP_065080
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
36.74kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
KDFIKAQDLSNLENTVAALKSEFQKTLNDKTENQKSLEENLATAKHDLLRVQEQLHMAEKELEKKFQQTAAYRNMKEILTKKNDQIKDLRKRLAQYEPED
RUO
LZTFL1
Wheat Germ (in vitro)
GST
Liquid
Antibody Production, ELISA, Protein Array, Western Blot
54585
LZTFL1 (Human) Recombinant Protein (Q01)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
FLJ36386
LZTFL1
Recombinant
wheat germ expression system
Suggerimenti di prodotto

Suggerimenti di prodotto

Videos
SDS
Documenti

Documenti

Certificati
Offerte speciali

Offerte speciali