missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human LECT2 Partial ORF (NP_002293.2, 76 a.a. - 151 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Brand: Abnova™ H00003950-Q01.10ug
Additional Details : Weight : 0.00010kg
Description
This gene encodes a secreted, 16 kDa protein that acts as a chemotactic factor to neutrophils and stimulates the growth of chondrocytes and osteoblasts. This protein has high sequence similarity to the chondromodulin repeat regions of the chicken myb-induced myeloid 1 protein. A polymorphism in this gene may be associated with rheumatoid arthritis. [provided by RefSeq]
Sequence: GQEKPYQNKNAINNGVRISGRGFCVKMFYIKPIKYKGPIKKGEKLGTLLPLQKVYPGIQSHVHIENCDSSDPTAYLSpecifications
| NP_002293.2 | |
| Liquid | |
| 3950 | |
| LECT2 (Human) Recombinant Protein (Q01) | |
| 10 ug | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| MGC126628/chm-II/chm2 | |
| LECT2 | |
| Yes | |
| wheat germ expression system |
| Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein) | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 34.1kDa | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| GQEKPYQNKNAINNGVRISGRGFCVKMFYIKPIKYKGPIKKGEKLGTLLPLQKVYPGIQSHVHIENCDSSDPTAYL | |
| RUO | |
| LECT2 | |
| Wheat Germ (in vitro) | |
| GST |