missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human LCN9 Full-length ORF (AAI48848.1, 1 a.a. - 176 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00392399-P01.25ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16100604

  • 508.00€ / 25µg
Estimated Shipment: 04-07-2024
to see stock.
Add to basket

Description

Description

Members of the lipocalin family, such as LCN9, have a common structure consisting of an 8-stranded antiparallel beta-barrel that forms a cup-shaped ligand-binding pocket or calyx. Lipocalins generally bind small hydrophobic ligands and transport them to specific cells (Suzuki et al., 2004 [PubMed 15363845]).[supplied by OMIM]

Sequence: MALLLLSLGLSLIAAQEFDPHTVMQRNYNVARVSGVWYSIFMASDDLNRIKENGDLRVFVRNIEHLKNGSLIFDFEYMVQGECVAVVVVCEKTEKNGEYSINYEGQNTVAVSETDYRLFITFHLQNFRNGTETHTLALYETCEKYGLGSQNIIDLTNKDPCYSKHYRSPPRPPMRW
Specifications

Specifications

AAI48848.1
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
46.31kDa
Glutathione Sepharose 4 Fast Flow
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
9230102I19Rik
LCN9
Recombinant
wheat germ expression system
Antibody Production, Protein Array, ELISA, Western Blot
392399
LCN9 (Human) Recombinant Protein (P01)
12.5% SDS-PAGE Stained with Coomassie Blue.
MALLLLSLGLSLIAAQEFDPHTVMQRNYNVARVSGVWYSIFMASDDLNRIKENGDLRVFVRNIEHLKNGSLIFDFEYMVQGECVAVVVVCEKTEKNGEYSINYEGQNTVAVSETDYRLFITFHLQNFRNGTETHTLALYETCEKYGLGSQNIIDLTNKDPCYSKHYRSPPRPPMRW
RUO
LCN9
Wheat Germ (in vitro)
GST
Liquid
Product Suggestions

Product Suggestions

Videos
SDS
Documents

Documents

Certificates
Special Offers

Special Offers