missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human KCNK1 Partial ORF (NP_002236.1, 265 a.a. - 336 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00003775-Q01.10ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16100405

  • 335.00€ / 10µg
Estimated Shipment: 26-06-2024
to see stock.
Add to basket

Description

Description

This gene encodes one of the members of the superfamily of potassium channel proteins containing two pore-forming P domains. The product of this gene has not been shown to be a functional channel, however, it may require other non-pore-forming proteins for activity. [provided by RefSeq]

Sequence: ETFCELHELKKFRKMFYVKKDKDEDQVHIIEHDQLSFSSITDQAAGMKEDQKQNEPFVATQSSACVDGPANH
Specifications

Specifications

NP_002236.1
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
33.66kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
ETFCELHELKKFRKMFYVKKDKDEDQVHIIEHDQLSFSSITDQAAGMKEDQKQNEPFVATQSSACVDGPANH
RUO
KCNK1
Wheat Germ (in vitro)
GST
Liquid
Antibody Production, ELISA, Protein Array, Western Blot
3775
KCNK1 (Human) Recombinant Protein (Q01)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
DPK/HOHO/K2p1.1/KCNO1/TWIK-1/TWIK1
KCNK1
Recombinant
wheat germ expression system
Product Suggestions

Product Suggestions

Videos
SDS
Documents

Documents

Certificates
Special Offers

Special Offers