missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human KCNK1 Partial ORF (NP_002236.1, 265 a.a. - 336 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Brand: Abnova™ H00003775-Q01.10ug
Additional Details : Weight : 0.00010kg
Description
This gene encodes one of the members of the superfamily of potassium channel proteins containing two pore-forming P domains. The product of this gene has not been shown to be a functional channel, however, it may require other non-pore-forming proteins for activity. [provided by RefSeq]
Sequence: ETFCELHELKKFRKMFYVKKDKDEDQVHIIEHDQLSFSSITDQAAGMKEDQKQNEPFVATQSSACVDGPANHSpecifications
| NP_002236.1 | |
| Liquid | |
| 3775 | |
| KCNK1 (Human) Recombinant Protein (Q01) | |
| 10 ug | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| DPK/HOHO/K2p1.1/KCNO1/TWIK-1/TWIK1 | |
| KCNK1 | |
| Yes | |
| wheat germ expression system |
| Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein) | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 33.66kDa | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| ETFCELHELKKFRKMFYVKKDKDEDQVHIIEHDQLSFSSITDQAAGMKEDQKQNEPFVATQSSACVDGPANH | |
| RUO | |
| KCNK1 | |
| Wheat Germ (in vitro) | |
| GST |