missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human KCNE1 Partial ORF (NP_000210, 67 a.a. - 129 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00003753-Q01.25ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16107091

  • 508.00€ / 25µg
Estimated Shipment: 18-07-2024
to see stock.
Add to basket

Description

Description

The product of this gene belongs to the potassium channel KCNE family. Potassium ion channels are essential to many cellular functions and show a high degree of diversity, varying in their electrophysiologic and pharmacologic properties. This gene encodes a transmembrane protein known to associate with the product of the KVLQT1 gene to form the delayed rectifier potassium channel. Mutation in this gene are associated with both Jervell and Lange-Nielsen and Romano-Ward forms of long-QT syndrome. Alternatively spliced transcript variants encoding the same protein have been identified. [provided by RefSeq]

Sequence: RSKKLEHSNDPFNVYIESDAWQEKDKAYVQARVLESYRSCYVVENHLAIEQPNTHLPETKPSP
Specifications

Specifications

NP_000210
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
32.67kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
RSKKLEHSNDPFNVYIESDAWQEKDKAYVQARVLESYRSCYVVENHLAIEQPNTHLPETKPSP
RUO
KCNE1
Wheat Germ (in vitro)
GST
Liquid
Antibody Production, ELISA, Protein Array, Western Blot
3753
KCNE1 (Human) Recombinant Protein (Q01)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
FLJ18426/FLJ38123/FLJ94103/ISK/JLNS/JLNS2/LQT2/5/LQT5/MGC33114/MinK
KCNE1
Recombinant
wheat germ expression system
Product Suggestions

Product Suggestions

Videos
SDS
Documents

Documents

Certificates
Special Offers

Special Offers