missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human IER5 Partial ORF (NP_057629, 1 a.a. - 56 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Brand: Abnova™ H00051278-Q01.10ug
Additional Details : Weight : 0.00010kg
Description
This gene encodes a protein that is similar to other immediate early response proteins. In the mouse, a similar gene may play an important role in mediating the cellular response to mitogenic signals. Studies in rats found the expression of a similar gene to be increased after waking and sleep deprivation. [provided by RefSeq]
Sequence: MEFKLEAHRIVSISLGKIYNSRVQRGGIKLHKNLLVSLVLRSARQVYLSDPCPGLYSpecifications
| NP_057629 | |
| Liquid | |
| 51278 | |
| IER5 (Human) Recombinant Protein (Q01) | |
| 10 ug | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| MGC102760/SBBI48 | |
| IER5 | |
| Yes | |
| wheat germ expression system |
| Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein) | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 31.9kDa | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| MEFKLEAHRIVSISLGKIYNSRVQRGGIKLHKNLLVSLVLRSARQVYLSDPCPGLY | |
| RUO | |
| IER5 | |
| Wheat Germ (in vitro) | |
| GST |