missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human EPS8L2 Partial ORF (NP_073609, 615 a.a. - 714 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00064787-Q01.10ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16119726

  • 359.00€ / 10µg

Estimated Shipment: 04-10-2022
to see stock.
Add to basket

Description

Description

This gene encodes a member of the EPS8 gene family. The encoded protein, like other members of the family, is thought to link growth factor stimulation to actin organization, generating functional redundancy in the pathways that regulate actin cytoskeletal remodeling. [provided by RefSeq]

Sequence: ERSQPVSQPLTYESGPDEVRAWLEAKAFSPRIVENLGILTGPQLFSLNKEELKKVCGEEGVRVYSQLTMQKAFLEKQQSGSELEELMNKFHSMNQRRGED
Specifications

Specifications

NP_073609
Liquid
64787
EPS8L2 (Human) Recombinant Protein (Q01)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
EPS8R2/FLJ16738/FLJ21935/FLJ22171/MGC126530/MGC3088
EPS8L2
Yes
wheat germ expression system
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
36.74kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
ERSQPVSQPLTYESGPDEVRAWLEAKAFSPRIVENLGILTGPQLFSLNKEELKKVCGEEGVRVYSQLTMQKAFLEKQQSGSELEELMNKFHSMNQRRGED
RUO
EPS8L2
Wheat Germ (in vitro)
GST
Videos
SDS
Documents
Certificates
Special Offers

Special Offers