missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human EPS8L2 Partial ORF (NP_073609, 615 a.a. - 714 a.a.) Recombinant Protein with GST-tag at N-terminal

Name: Abnova&trade; Human EPS8L2 Partial ORF (NP_073609, 615 a.a. - 714 a.a.) Recombinant Protein with GST-tag at N-terminal
Brand: Abnova&trade;
SKU: p-7101876

Used for AP, Array, ELISA, WB-Re

335.00€ - 508.00€

Specifications

Accession Number	NP_073609
For Use With (Application)	Antibody Production, ELISA, Protein Array, Western Blot
Formulation	50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene ID (Entrez)	64787
Molecular Weight (g/mol)	36.74kDa

View More Specs

Products 2

Product Code	Brand	Quantity	Price	Quantity & Availability
Product Code	Brand	Quantity	Price	Quantity & Availability
16129726 View Documents Promotion Details missing translation for 'viewProductCertificates'	Abnova™ H00064787-Q01.25UG	25 ug	508.00€ 25µg View alternative products Save Up to »	Estimated Shipment: 07-06-2024 Log in to see stock.	Add to basket

16119726 View Documents Promotion Details missing translation for 'viewProductCertificates'	Abnova™ H00064787-Q01.10UG	10 ug	335.00€ 10µg View alternative products Save Up to »	Estimated Shipment: 07-06-2024 Log in to see stock.	Add to basket

Description

This gene encodes a member of the EPS8 gene family. The encoded protein, like other members of the family, is thought to link growth factor stimulation to actin organization, generating functional redundancy in the pathways that regulate actin cytoskeletal remodeling. [provided by RefSeq]

Sequence: ERSQPVSQPLTYESGPDEVRAWLEAKAFSPRIVENLGILTGPQLFSLNKEELKKVCGEEGVRVYSQLTMQKAFLEKQQSGSELEELMNKFHSMNQRRGED

Specifications

Accession Number	NP_073609
Formulation	50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Weight (g/mol)	36.74kDa
Quality Control Testing	12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Requirements	Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Gene Alias	EPS8R2/FLJ16738/FLJ21935/FLJ22171/MGC126530/MGC3088
Gene Symbol	EPS8L2
Recombinant	Recombinant
Expression System	wheat germ expression system

For Use With (Application)	Antibody Production, ELISA, Protein Array, Western Blot
Gene ID (Entrez)	64787
Name	EPS8L2 (Human) Recombinant Protein (Q01)
Immunogen	ERSQPVSQPLTYESGPDEVRAWLEAKAFSPRIVENLGILTGPQLFSLNKEELKKVCGEEGVRVYSQLTMQKAFLEKQQSGSELEELMNKFHSMNQRRGED
Regulatory Status	RUO
Common Name	EPS8L2
Species	Wheat Germ (in vitro)
Protein Tag	GST
Form	Liquid

Abnova™ Human EPS8L2 Partial ORF (NP_073609, 615 a.a. - 714 a.a.) Recombinant Protein with GST-tag at N-terminal

Specifications

Description

Specifications

Documents