missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human CPNE4 Partial ORF (NP_570720.1, 24 a.a. - 130 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Brand: Abnova™ H00131034-Q03.25ug
Additional Details : Weight : 0.02000kg
Description
Calcium-dependent membrane-binding proteins may regulate molecular events at the interface of the cell membrane and cytoplasm. This gene is one of several genes that encode a calcium-dependent protein containing two N-terminal type II C2 domains and an integrin A domain-like sequence in the C-terminus. [provided by RefSeq]
Sequence: TKVELRVACKGISDRDALSKPDPCVILKMQSHGQWFEVDRTEVIRTCINPVYSKLFTVDFYFEEVQRLRFEVHDISSNHNGLKEADFLGGMECTLGQIVSQRKLSKSSpecifications
| NP_570720.1 | |
| Liquid | |
| 131034 | |
| CPNE4 (Human) Recombinant Protein (Q03) | |
| 25 ug | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| COPN4/CPN4/MGC15604 | |
| CPNE4 | |
| Yes | |
| wheat germ expression system |
| Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein) | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 37.40kDa | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| TKVELRVACKGISDRDALSKPDPCVILKMQSHGQWFEVDRTEVIRTCINPVYSKLFTVDFYFEEVQRLRFEVHDISSNHNGLKEADFLGGMECTLGQIVSQRKLSKS | |
| RUO | |
| CPNE4 | |
| Wheat Germ (in vitro) | |
| GST |