missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human ARR3 Full-length ORF (AAH12096, 1 a.a. - 359 a.a.) Recombinant Protein with GST-tag at N-terminal

Name: Abnova&trade; Human ARR3 Full-length ORF (AAH12096, 1 a.a. - 359 a.a.) Recombinant Protein with GST-tag at N-terminal
Brand: Abnova&trade;
SKU: 16101901
Price: 508.00 EUR

Used for AP, Array, ELISA, WB-Re

Brand: Abnova™ H00000407-P01.25ug

Additional Details : Weight : 0.00010kg

View more versions of this product

Product Code. 16101901

508.00€ / 25µg

Quantity

Estimated Shipment: 31-05-2024
to see stock.

Add to basket

Description

Sequence: MSKVFKKTSSNGKLSIYLGKRDFVDHVDTVEPIDGVVLVDPEYFKCRKLFVMLTCAFRYGRDDLEVIGLTFRKDLYVQTLQVVPAESSSPQGPLTVLQERLLHKLGDNAYPFTLQMVTNLPCSVTLQPGPEDAGKPCGIDFEVKSFCAENPEETVSKRDYVRLVVRKVQFAPPEAGPGPSAQTIRRFLLSAQPLQLQAWMDREVHYHGEPISVNVSINNCTNKVIKKIKISVDQITDVVLYSLDKYTKTVFIQEFTETVAANSSFSQSFAVTPILAASCQKRGLALDGKLKHEDTNLASSTIIRPGMDKELLGILVSYKVRVNLMVSCGGILGDLTASDVGVELPLVLIHPKPSYEAAR

Specifications

Accession Number	AAH12096
Formulation	50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Weight (g/mol)	65.01kDa
Purification Method	Glutathione Sepharose 4 Fast Flow
Quantity	25 ug
Regulatory Status	RUO
Common Name	ARR3
Species	Wheat Germ (in vitro)
Protein Tag	GST
Form	Liquid

For Use With (Application)	Antibody Production, Protein Array, ELISA, Western Blot
Gene ID (Entrez)	407
Name	ARR3 (Human) Recombinant Protein (P01)
Quality Control Testing	12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Requirements	Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Gene Alias	ARRX
Gene Symbol	ARR3
Recombinant	Recombinant
Expression System	wheat germ expression system

Product Suggestions

Abnova™ Human ARR3 Full-length ORF (AAH12096, 1 a.a. - 359 a.a.) Recombinant Protein with GST-tag at N-terminal

Description

Specifications

Product Suggestions

Documents

Special Offers