missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human ARL6IP5 Partial ORF (NP_006398, 1 a.a. - 64 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Brand: Abnova™ H00010550-Q01.25ug
Additional Details : Weight : 0.00010kg
Description
Expression of this gene is affected by vitamin A. The encoded protein of this gene may be associated with the cytoskeleton. A similar protein in rats may play a role in the regulation of cell differentiation. The rat protein binds and inhibits the cell membrane glutamate transporter EAAC1. The expression of the rat gene is upregulated by retinoic acid, which results in a specific reduction in EAAC1-mediated glutamate transport. [provided by RefSeq]
Sequence: MDVNIAPLRAWDDFFPGSDRFARPDFRDISKWNNRVVSNLLYYQTNYLVVAAMMISIVGFLSPFSpecifications
| NP_006398 | |
| Liquid | |
| 10550 | |
| ARL6IP5 (Human) Recombinant Protein (Q01) | |
| 25 ug | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| DERP11/GTRAP3-18/HSPC127/JWA/PRAF3/addicsin/hp22/jmx | |
| ARL6IP5 | |
| Yes | |
| wheat germ expression system |
| Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein) | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 32.78kDa | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| MDVNIAPLRAWDDFFPGSDRFARPDFRDISKWNNRVVSNLLYYQTNYLVVAAMMISIVGFLSPF | |
| RUO | |
| ARL6IP5 | |
| Wheat Germ (in vitro) | |
| GST |