missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human AP4E1 Partial ORF (NP_031373, 1038 a.a. - 1137 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00023431-Q01.25ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16164676

  • 545.00€ / 25µg

Estimated Shipment: 29-07-2022
to see stock.
Add to basket

Description

Description

The heterotetrameric adaptor protein (AP) complexes sort integral membrane proteins at various stages of the endocytic and secretory pathways. AP4 is composed of 2 large chains, beta-4 (AP4B1; MIM 607245) and epsilon-4 (AP4E1), a medium chain, mu-4 (AP4M1; MIM 602296), and a small chain, sigma-4 (AP4S1; MIM 607243).[supplied by OMIM]

Sequence: SDDFGKLWLSFANDVKQNVKMSESQAALPSALKTLQQKLRLHIIEIIGNEGLLACQLLPSIPCLLHCRVHADVLALWFRSSCSTLPDYLLYQCQKVMEGS
Specifications

Specifications

NP_031373
Liquid
23431
AP4E1 (Human) Recombinant Protein (Q01)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
DKFZp686L12167
AP4E1
Yes
wheat germ expression system
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
36.74kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
SDDFGKLWLSFANDVKQNVKMSESQAALPSALKTLQQKLRLHIIEIIGNEGLLACQLLPSIPCLLHCRVHADVLALWFRSSCSTLPDYLLYQCQKVMEGS
RUO
AP4E1
Wheat Germ (in vitro)
GST
Videos
SDS
Documents
Certificates
Special Offers

Special Offers