missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human ADMR Partial ORF (NP_009195, 1 a.a. - 54 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Brand: Abnova™ H00011318-Q01.10ug
Additional Details : Weight : 0.00010kg
Description
Adrenomedullin is a potent vasodilator peptide that exerts major effects on cardiovascular function. This gene encodes a seven-transmembrane protein that belongs to the family 1 of G-protein coupled receptors. Studies of the rat counterpart suggest that the encoded protein may function as a receptor for adrenomedullin. [provided by RefSeq]
Sequence: MSVKPSWGPGPSEGVTAVPTSDLGEIHNWTELLDLFNHTLSECHVELSQSTKRVSpecifications
| NP_009195 | |
| Liquid | |
| 11318 | |
| ADMR (Human) Recombinant Protein (Q01) | |
| 10 ug | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| 7TMR/ADMR/AM-R/AMR/G10D/MGC34399/gamrh/hrhAMR | |
| GPR182 | |
| Yes | |
| wheat germ expression system |
| Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein) | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 31.68kDa | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| MSVKPSWGPGPSEGVTAVPTSDLGEIHNWTELLDLFNHTLSECHVELSQSTKRV | |
| RUO | |
| GPR182 | |
| Wheat Germ (in vitro) | |
| GST |