missing translation for 'onlineSavingsMsg'
Learn More

HSD17B8 Antibody, Novus Biologicals™

Product Code. 18446410 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mL
25 μL
Unit Size:
0.10mL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18446410 25 μL 25µL
18290008 0.1 mL 0.10mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18446410 Supplier Novus Biologicals Supplier No. NBP18430925ul

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Rabbit Polyclonal Antibody

HSD17B8 Polyclonal specifically detects HSD17B8 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
TRUSTED_SUSTAINABILITY

Specifications

Antigen HSD17B8
Applications Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.4 ug/ml, Immunohistochemistry 1:1000 - 1:2500, Immunohistochemistry-Paraffin 1:1000 - 1:2500
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias D6S2245EdJ1033B10.9, EC 1.1.1.-, EC 1.1.1.62, EC 1.1.1.63,17-beta-HSD 8, estrogen 17-oxidoreductase, FABGLestradiol 17-beta-dehydrogenase 8, H2-KE6, HKE6FabG (beta-ketoacyl-[acyl-carrier-protein] reductase, E coli) like (E. coli), hydroxysteroid (17-beta) dehydrogenase 8,3-oxoacyl-[acyl-carrier-protein] reductase, ke-6, KE6, Ke-6,17-beta-hydroxysteroid dehydrogenase 8, Protein Ke6, Really interesting new gene 2 protein, RING2FABG, SDR30C1, short chain dehydrogenase/reductase family 30C, member 1, Testosterone 17-beta-dehydrogenase 8
Gene Symbols HSD17B8
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:GQTNYAASKAGVIGLTQTAARELGRHGIRCNSVLPGFIATPMTQKVPQKVVDKITEMIPMGHLGDPEDVADVVAFLASEDSGY
Purification Method Affinity Purified
Quantity 25 μL
Regulatory Status RUO
Research Discipline metabolism
Primary or Secondary Primary
Gene ID (Entrez) 7923
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.