missing translation for 'onlineSavingsMsg'
Learn More
Learn More
HSD17B2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 1 publication
Brand: Novus Biologicals NBP1-92011-25ul
This item is not returnable.
View return policy
Description
HSD17B2 Polyclonal specifically detects HSD17B2 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Specifications
| HSD17B2 | |
| Polyclonal | |
| Western Blot 0.4 μg/mL, Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 1-4 μg/mL, Immunohistochemistry-Paraffin 1:20-1:50 | |
| P37059 | |
| HSD17B2 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:AVTMFSSVMRLELSKWGIKVASIQPGGFLTNIAGTSDKWEKLEKDILDHLPAEVQEDYGQDYILAQRNFLLLINSLASKDFSPVL | |
| 25 μL | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 17-beta-hydroxysteroid dehydrogenase type 2, 20 alpha-hydroxysteroid dehydrogenase, E2DH, EC 1.1.1.62,17-beta-HSD 2, EC 1.1.1.63, EDH17B220-alpha-HSD, estradiol 17-beta-dehydrogenase 2, HSD17, hydroxysteroid (17-beta) dehydrogenase 2, Microsomal 17-beta-hydroxysteroid dehydrogenase, SDR9C2, short chain dehydrogenase/reductase family 9C, member 2, Testosterone 17-beta-dehydrogenase | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| 3294 | |
| Human | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction