missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Histone H2AY/macroH2A.1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
426.00€ - 624.00€
Specifications
| Antigen | Histone H2AY/macroH2A.1 |
|---|---|
| Applications | Western Blot, Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18210415
|
Novus Biologicals
NBP2-56819 |
100 μL |
624.00€
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18684556
|
Novus Biologicals
NBP2-56819-25ul |
25 μL |
426.00€
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
Histone H2AY/macroH2A.1 Polyclonal specifically detects Histone H2AY/macroH2A.1 in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.Specifications
| Histone H2AY/macroH2A.1 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| core histone macro-H2A.1, H2A histone family, member Y, H2A.y, H2A/y, H2AF12M, H2AFJ, Histone H2A.y, Histone macroH2A1, histone macroH2A1.1, histone macroH2A1.2, MACROH2A1, MACROH2A1.1, macroH2A1.2, Medulloblastoma antigen MU-MB-50.205, mH2A1 | |
| H2AFY | |
| IgG | |
| Affinity Purified |
| Western Blot, Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| 9555 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:GKLEAIITPPPAKKAKSPSQKKPVSKKAGGKKGARKSKKKQGEVSKAASADSTTEGTPADGFTVLSTK | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title