missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
HINT1 Polyclonal specifically detects HINT1 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Specifications
Specifications
| Antigen | HINT1 |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Western Blot 0.4 ug/ml, Immunohistochemistry 1:500 - 1:1000, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:500-1:1000 |
| Formulation | PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide |
| Gene Alias | Adenosine 5'-monophosphoramidase, EC 3.-, HINT, histidine triad nucleotide binding protein 1, histidine triad nucleotide-binding protein, histidine triad nucleotide-binding protein 1, PKCI1, PKCI-1FLJ30414, PRKCNH1FLJ32340, Protein kinase C inhibitor 1, Protein kinase C-interacting protein 1 |
| Gene Symbols | HINT1 |
| Host Species | Rabbit |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:IPKKHISQISVAEDDDESLLGHLMIVGKKCAADLGLNKGYRMVVNEGSDGGQSVYHVHLHVL |
| Show More |
For Research Use Only
Titolo del prodotto
Facendo clic su Invia, l'utente riconosce che potrebbe essere contattato da Fisher Scientific in merito al feedback fornito in questo modulo. Non condivideremo le vostre informazioni per altri scopi. Tutte le informazioni di contatto fornite saranno conservate in conformità con la nostra Politica sulla privacy. Informativa sulla privacy.
Individuate un'opportunità di miglioramento?