missing translation for 'onlineSavingsMsg'
Learn More
Learn More
HECTD1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-38608-100ul
This item is not returnable.
View return policy
Description
HECTD1 Polyclonal antibody specifically detects HECTD1 in Human samples. It is validated for ELISA,Western Blot
Specifications
| HECTD1 | |
| Polyclonal | |
| Western Blot 1:500 - 1:2000, ELISA | |
| E3 ligase for inhibin receptor, E3 ubiquitin-protein ligase HECTD1, EC 6.3.2.-, EULIR, HECT domain containing 1, HECT domain-containing protein 1, KIAA1131FLJ38315 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 2518-2610 of human HECTD1 (NP_056197.3).,, Sequence:, PGFLRFVRVLCGMSSDERKAFLQFTTGCSTLPPGGLANLHPRLTVVRKVDATDASYPSVNTCVHYLKLPEYSSEEIMRERLLAATMEKGFHLN | |
| 100 μL | |
| Primary | |
| Human | |
| Purified |
| ELISA, Western Blot | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| 25831 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction