missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ HAMP Recombinant Protein

Product Code. 16192993
Click to view available options
Quantity:
10 μg
25 μg
Unit Size:
10µg
25µg
This item is not returnable. View return policy

Product Code. 16192993

Brand: Abnova™ H00057817P01.25ug

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Human HAMP full-length ORF (AAH20612, 25 a.a. - 84 a.a.) recombinant protein with GST-tag at N-terminal

The product encoded by this gene is involved in the maintenance of iron homeostasis, and it is necessary for the regulation of iron storage in macrophages, and for intestinal iron absorption. The preproprotein is post-translationally cleaved into mature peptides of 20, 22 and 25 amino acids, and these active peptides are rich in cysteines, which form intramolecular bonds that stabilize their beta-sheet structures. These peptides exhibit antimicrobial activity.

  • Molecular weight: 32.34kDa
  • Preparation method: in vitro wheat germ expression system
  • Purification: Glutathione Sepharose 4 Fast Flow
  • Storage Buffer: 50mM Tris-HCI, 10mM reduced Glutathione, pH=8 in the elution buffer
  • Quality Control Testing: 12.5% SDS-PAGE stained with Coomassie Blue

Sequence:
SVFPQQTGQLAELQPQDRAGARASWMPMFQRRRRRDTHFPICIFCCGCCHRSKCGMCCKT

Best use within three months from the date of receipt of this protein.

ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array

Specifications

Accession Number AAH20612
For Use With (Application) Antibody Production, Protein Array, ELISA, Western Blot
Formulation 50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer
Gene ID (Entrez) 57817
Molecular Weight (g/mol) 32.34
Name HAMP (Human) Recombinant Protein (P01)
pH Range 8
Preparation Method In vitro wheat germ expression system
Purification Method Glutathione Sepharose 4 Fast Flow
Quality Control Testing 12.5% SDS-PAGE Stained with Coomassie Blue.
Quantity 25 μg
Source Wheat Germ (in vitro)
Immunogen SVFPQQTGQLAELQPQDRAGARASWMPMFQRRRRRDTHFPICIFCCGCCHRSKCGMCCKT
Storage Requirements Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Gene Alias HEPC/HEPCIDIN/HFE2B/LEAP-1/LEAP1/PLTR
Common Name HAMP
Gene Symbol HAMP
Cross Reactivity Human
Species Wheat Germ (in vitro)
Recombinant Recombinant
Protein Tag GST
Form Solution
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.