missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ HACE1 (Human) Recombinant Protein

Human HACE1 partial ORF ( NP_065822, 800 a.a. - 909 a.a.) recombinant protein with GST-tag at N-terminal.

Brand:  Abnova™ H00057531-Q01.25ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16122763

  • 545.00€ / 25µg

Estimated Shipment: 20-09-2022
to see stock.
Add to basket

Description

Description

  • Sequence: TEYTSGYEREDPVIQWFWEVVEDITQEERVLLLQFVTGSSRVPHGGFANIMGGSGLQNFTIAAVPYTPNLLPTSSTCINMLKLPEYPSKEILKDRLLVALHCGSYGYTMA
Specifications

Specifications

NP_065822
HECT domain and ankyrin repeat containing, E3 ubiquitin protein ligase 1
125% SDS-PAGE Stained with Coomassie Blue
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Wheat Germ (in vitro)
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer
57531
Wheat germ expression system
25 μg
HACE1
GST
Videos
SDS
Documents
Certificates
Special Offers

Special Offers