missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ HACE1 (Human) Recombinant Protein

Human HACE1 partial ORF ( NP_065822, 800 a.a. - 909 a.a.) recombinant protein with GST-tag at N-terminal.

335.00€ - 508.00€

Accession Number	NP_065822
Gene ID (Entrez)	57531
Name	HECT domain and ankyrin repeat containing, E3 ubiquitin protein ligase 1
Preparation Method	Wheat germ expression system
Quality Control Testing	125% SDS-PAGE Stained with Coomassie Blue

View More Specs

Products 2

Product Code	Brand	Quantity	Price	Quantity & Availability
Product Code	Brand	Quantity	Price	Quantity & Availability
16112763 View Documents Promotion Details missing translation for 'viewProductCertificates'	Abnova™ H00057531-Q01.10UG	10 μg	335.00€ 10µg View alternative products Save Up to »	Estimated Shipment: 31-05-2024 Log in to see stock.	Add to basket

16122763 View Documents Promotion Details missing translation for 'viewProductCertificates'	Abnova™ H00057531-Q01.25UG	25 μg	508.00€ 25µg View alternative products Save Up to »	Estimated Shipment: 31-05-2024 Log in to see stock.	Add to basket

Description

Sequence: TEYTSGYEREDPVIQWFWEVVEDITQEERVLLLQFVTGSSRVPHGGFANIMGGSGLQNFTIAAVPYTPNLLPTSSTCINMLKLPEYPSKEILKDRLLVALHCGSYGYTMA

Specifications

Accession Number	NP_065822
Name	HECT domain and ankyrin repeat containing, E3 ubiquitin protein ligase 1
Quality Control Testing	125% SDS-PAGE Stained with Coomassie Blue
Gene Symbol	HACE1
Protein Tag	GST

Gene ID (Entrez)	57531
Preparation Method	Wheat germ expression system
Storage Requirements	Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Species	Wheat Germ (in vitro)
Buffer	50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer

Description