missing translation for 'onlineSavingsMsg'
Learn More
Learn More
H1FX Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
391.65€ - 590.10€
Specifications
| Antigen | H1FX |
|---|---|
| Dilution | Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:200 - 1:500 |
| Applications | Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18443502
|
Novus Biologicals
NBP2-31980-25ul |
25 μL |
415.00€ 391.65€ / 25µL Save 23.35€ 5% Off |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18163173
|
Novus Biologicals
NBP2-31980 |
0.1 mL |
624.00€ 590.10€ / 0.10mL Save 33.90€ 5% Off |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
H1FX Polyclonal specifically detects H1FX in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
| H1FX | |
| Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| H1 histone family, member X, H1X, histone H1x, MGC15959, MGC8350 | |
| H1FX | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| Q92522 | |
| 8971 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: ALPVTTAEGMAKKVTKAGGSAALSPSKKRKNSKKKNQPGKYSQLVVETIRRLGERNGSSLAKIYTEAKKVPWFDQQNG | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title