missing translation for 'onlineSavingsMsg'
Learn More
Learn More
GVQW1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
280.00€
Specifications
| Antigen | GVQW1 |
|---|---|
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
GVQW1 Polyclonal specifically detects GVQW1 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
| GVQW1 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| 101362076 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:STPGVLCKTGMGREPIPETQCHFANSMCSLHVSVPYFGNSPNISNFFRWSLALS | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| BA205M20.5, GVQW Motif Containing 1, GVQW Motif-Containing Protein 1, TIGD1L2, Tigger Transposable Element Derived 1-Like 2, Tigger Transposable Element-Derived 1-Like Protein 2 | |
| GVQW1 | |
| IgG | |
| Affinity Purified |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title