missing translation for 'onlineSavingsMsg'
Learn More
Learn More
GSTA3 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
466.00€
Specifications
| Antigen | GSTA3 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
GSTA3 Polyclonal specifically detects GSTA3 in Human samples. It is validated for Western Blot.Specifications
| GSTA3 | |
| Polyclonal | |
| Rabbit | |
| Q16772 | |
| 2940 | |
| Synthetic peptides corresponding to GSTA3(glutathione S-transferase alpha 3) The peptide sequence was selected from the middle region of GSTA3. Peptide sequence SSLISNFPLLKALKTRISNLPTVKKFLQPGSPRKPPADAKALEEARKIFR. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| EC 2.5.1.18, glutathione S-alkyltransferase A3, glutathione S-aralkyltransferase A3, glutathione S-aryltransferase A3, glutathione S-transferase A3, Glutathione S-transferase A3-3, glutathione S-transferase alpha 3, GST class-alpha member 3, GSTA3-3, GTA3, MGC22232, S-(hydroxyalkyl)glutathione lyase A3 | |
| GSTA3 | |
| IgG | |
| 25 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title