missing translation for 'onlineSavingsMsg'
Learn More
Learn More
GSG2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
369.00€ - 529.00€
Specifications
| Antigen | GSG2 |
|---|---|
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18248541
|
Novus Biologicals
NBP2-55174 |
100 μL |
529.00€
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18640778
|
Novus Biologicals
NBP2-55174-25ul |
25 μL |
369.00€
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
GSG2 Polyclonal specifically detects GSG2 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
| GSG2 | |
| Polyclonal | |
| Rabbit | |
| Cell Cycle and Replication | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| 83903 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:QHRRRFFNSSGSSDASIGDPSQSDDPDDPDDPDFPGSPVRRRRRCPGGRVPKDRPSLTVTPKRWKLRARPSLTVTPRRLGLRARPPQKCSTP | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| Human | |
| EC 2.7.11.1, germ cell associated 2 (haspin), Germ cell-specific gene 2 protein, Haploid germ cell-specific nuclear protein kinase, HASPIN, H-haspin, serine/threonine-protein kinase haspin | |
| GSG2 | |
| IgG | |
| Affinity Purified |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title