missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Granzyme M Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
280.00€ - 572.00€
Specifications
| Antigen | Granzyme M |
|---|---|
| Dilution | Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18426631
|
Novus Biologicals
NBP2-14079-25ul |
25ul |
280.00€
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18114400
|
Novus Biologicals
NBP2-14079 |
0.1 mL |
572.00€
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
Granzyme M Polyclonal specifically detects Granzyme M in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| Granzyme M | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human | |
| EC 3.4.21, EC 3.4.21.-, granzyme M, granzyme M (lymphocyte met-ase 1), Hu-Met-1, LMET1, lymphocyte met-ase 1, Met-1 serine protease, MET1met-ase, Met-ase, Natural killer cell granular protease | |
| GZMM | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| Polyclonal | |
| Rabbit | |
| Adaptive Immunity, Apoptosis, Cancer, Immunology, Innate Immunity, Tumor Suppressors | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 3004 | |
| This antibody was developed against a recombinant protein corresponding to the amino acids: PSMVCLAADSKDQAPCKGDSGGPLVCGKGRVLAGVLSFSSRVCTDIFKPPVATAVAPYVSWIRKVTGR | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title