missing translation for 'onlineSavingsMsg'
Learn More
Learn More
GPR32 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-35632-100ul
This item is not returnable.
View return policy
Description
GPR32 Polyclonal antibody specifically detects GPR32 in Human,Mouse,Rat samples. It is validated for ELISA,Western Blot
Specifications
| GPR32 | |
| Polyclonal | |
| Western Blot 1:500 - 1:2000, ELISA | |
| G protein-coupled receptor 32, probable G-protein coupled receptor 32 | |
| A synthetic peptide corresponding to a sequence within amino acids 1-100 of human GPR32 (NP_001497.1).,, Sequence:, MNGVSEGTRGCSDRQPGVLTRDRSCSRKMNSSGCLSEEVGSLRPLTVVILSASIVVGVLGNGLVLWMTVFRMARTVSTVCFFHLALADFMLSLSLPIAMY | |
| 100 μL | |
| GPCR | |
| 2854 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| ELISA, Western Blot | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse, Rat | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction