missing translation for 'onlineSavingsMsg'
Learn More
Learn More
GODZ Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
415.00€
Specifications
| Antigen | GODZ |
|---|---|
| Dilution | Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
Description
GODZ Polyclonal specifically detects GODZ in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| GODZ | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 51304 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:FLHCFEEDWTTYGLNREEMAETGISLHEKMQPLNFSSTECSSFSPPTT | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| DHHC domain containing 3, DKFZp313D2314, EC 2.3.1, EC 2.3.1.-, FLJ20209, FLJ45940, Protein DHHC1, zinc finger, DHHC-type containing 3 | |
| ZDHHC3 | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title